FOR RESEARCH USE ONLY. The content provided in this article is for educational and informational purposes only and is based on published scientific literature. The compounds discussed are not approved by the FDA for human or veterinary use. They are strictly intended for laboratory research and in vitro experimentation. Pure Health Peptides does not endorse or encourage the use of these products outside of a controlled research setting.
The LL-37 peptide is a synthetic version of the only cathelicidin-family antimicrobial peptide found in humans, studied in preclinical and in vitro research for two linked properties: the way it interacts with lipid membranes, and the signaling roles that extend beyond that interaction. Those two threads are what make LL-37 a defined host-defense research subject rather than a simple antimicrobial. This article describes the structure of the LL-37 peptide, the peptide-membrane interaction research behind it, its studied immunomodulatory signaling, and how the material sits alongside the rest of the immune-research catalog and is verified.
Research Snapshot
- LL-37 is a synthetic 37-residue peptide corresponding to the C-terminal sequence of the human cathelicidin protein hCAP18 (sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES). Its molecular formula is C205H340N60O53 and its molecular weight is approximately 4,492.11 g/mol.
- It is the single human member of the cathelicidin family of antimicrobial peptides, which is why it is a reference tool in host-defense research (Dürr et al., 2006).
- Its defining structural feature is amphipathicity: it folds into a helix with separated charged and hydrophobic faces, and that arrangement drives its interaction with lipid membranes, the property most studied in vitro.
- Beyond membrane interaction, LL-37 is studied for immunomodulatory signaling roles, which is why the literature describes it as a multifunctional or “factotum” peptide (Vandamme et al., 2012).
- Pure Health Peptides supplies LL-37 as a lyophilized Vial, part of the wider catalog. Every lot is finished and tested in the USA, routed through independent, ISO/IEC 17025-accredited testing by Ethos Analytics as the exclusive testing partner.
Introduction
Cathelicidins are a family of host-defense peptides found across many species, and humans have exactly one: the peptide released from the hCAP18 precursor, known by the first two residues of its active sequence as LL-37. That uniqueness is the starting point for its research interest. A single, well-characterized human cathelicidin gives researchers a defined reference molecule for studying how this class of peptide behaves.
This article stays with that molecule and the preclinical research built on it: the amphipathic structure, the peptide-membrane interaction that defines the antimicrobial-research side, the broader immunomodulatory signaling it is studied for, and the verification chain underneath the material. It describes findings in preclinical and in vitro systems and holds to research-use framing throughout, with no extension to applied or clinical use.
The LL-37 Peptide: Structure of the Human Cathelicidin
LL-37 is a 37-residue peptide, and its behavior follows directly from its sequence. It is rich in the basic residues arginine and lysine, giving it a strong net positive charge, and when it folds it forms an amphipathic helix: the charged residues cluster on one face and the hydrophobic residues on the other. Its molecular weight is approximately 4,492.11 g/mol.
That amphipathic arrangement is the whole mechanism in miniature. A positively charged, membrane-facing helix is drawn to the negatively charged surfaces characteristic of microbial membranes, and the hydrophobic face allows it to insert. Because LL-37 is a defined synthetic sequence, its identity is confirmed by mass spectrometry against its theoretical mass, the basis of lot-level verification.
Peptide-Membrane Interaction and Host-Defense Research
The antimicrobial-research side of LL-37 is fundamentally a membrane story. In vitro, the peptide’s cationic, amphipathic helix associates with anionic lipid membranes and disrupts their integrity, and this peptide-membrane interaction is the property most closely studied in structural and biophysical research (Dürr et al., 2006).
Researchers use LL-37 as a model system for how a natural host-defense peptide recognizes and destabilizes a membrane, work that sits at the intersection of structural biology and antimicrobial-peptide research.
Framed correctly, this is a research property, not an applied one: the studies describe how the molecule behaves against defined membrane systems in controlled conditions. That mechanistic clarity, a single human cathelicidin with a well-understood membrane interaction, is exactly why LL-37 is such a widely used reference peptide.
Immunomodulatory Signaling Research
LL-37 is studied for more than membrane disruption. The literature characterizes it as a multifunctional peptide with roles in cell signaling, chemotaxis, and the modulation of inflammatory responses in preclinical models, which is why it is sometimes called a “factotum” of the innate immune system (Vandamme et al., 2012).
These signaling roles are distinct from the direct membrane interaction and are studied through different experimental approaches. This dual character is the reason LL-37 sits so firmly in immune research.
It is at once a structural model for antimicrobial peptide-membrane interaction and a signaling molecule studied for its place in innate-immune pathways, both strictly in the preclinical and in vitro terms the literature uses.
LL-37 in the Immune-Research Toolkit
LL-37 is most useful alongside the other immune and inflammatory research compounds in the catalog, where each brings a different mechanism. KPV, the melanocortin-derived tripeptide, is studied for anti-inflammatory signaling and is offered across three carrier formats, Vial, Capsule, and Liquid; the companion KPV article covers that pathway. Thymosin Alpha-1 is studied for immunomodulatory signaling, detailed in its own article, and the thymic bioregulators Thymogen and Thymalin round out the immune corner.
Held together, these give a research program several mechanistically distinct entry points into innate-immune and inflammatory pathways: a cathelicidin, a melanocortin tripeptide, and thymic peptides. LL-37 is the host-defense and membrane-interaction reference among them. Each is a separate tool rather than a substitute for another.
Verification
Underneath the compound is the verification chain. Pure Health Peptides does not manufacture the material; production is sourced from qualified third-party manufacturers, and the material is finished and tested in the USA.
Every lot is routed through independent, ISO/IEC 17025-accredited testing by Ethos Analytics as the exclusive testing partner, and each qualified lot’s Certificate of Analysis is published in the COA Library, in the vial section, retrievable by batch ID. For a lyophilized vialed peptide the appropriate panel extends beyond identity, purity, and quantity to include endotoxin and microbial limits, because contamination can enter downstream of synthesis through handling, lyophilization, vial filling, storage, and transit.
The Testing Process page documents how that verification runs, and the Manufacturing Process page covers where the material comes from. The guide to reading a Certificate of Analysis walks through the panel field by field.
Where LL-37 Sits in Host-Defense Research
For researchers studying innate immunity, LL-37 is a specific and well-characterized tool: the one human cathelicidin, with an amphipathic structure that makes it a model for peptide-membrane interaction and a signaling profile that extends into immunomodulatory research.
Its value rests on that dual nature and on how thoroughly it has been characterized. As research on antimicrobial peptides and innate-immune signaling continues, LL-37 remains a central reference molecule, and it holds a clear place in the host-defense corner of the catalog.
Frequently Asked Questions
What is the LL-37 peptide?
LL-37 is a synthetic 37-residue peptide corresponding to the active sequence of the human cathelicidin protein hCAP18. Its molecular formula is C205H340N60O53 and its molecular weight is approximately 4,492.11 g/mol.
Why is LL-37 called a host-defense peptide?
It is the only human member of the cathelicidin family of antimicrobial peptides, a class central to innate host defense, which is why it is used as a reference molecule in that research area.
What is LL-37 studied for in research?
Two main things: its interaction with lipid membranes (the antimicrobial-research side), and its broader immunomodulatory signaling roles, both in preclinical and in vitro systems.
What makes LL-37 interact with membranes?
Its amphipathic helical structure. A positively charged face is drawn to anionic microbial membranes and a hydrophobic face allows insertion, which disrupts membrane integrity in vitro.
What carrier format is LL-37 available in, and how is it verified?
A lyophilized vial. Every lot is finished and tested in the USA and routed through independent, ISO/IEC 17025-accredited testing by Ethos Analytics, with a lot-specific Certificate of Analysis published in the COA Library.
References
- Dürr UHN, Sudheendra US, Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et Biophysica Acta (Biomembranes), 2006;1758(9):1408-1425. https://doi.org/10.1016/j.bbamem.2006.03.030
- Vandamme D, et al. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology, 2012;280(1):22-35. https://doi.org/10.1016/j.cellimm.2012.11.009
- Bals R, Wilson JM. Cathelicidins, a family of multifunctional antimicrobial and immunomodulatory peptides. Cellular and Molecular Life Sciences, 2003;60(4):711-720. https://pubmed.ncbi.nlm.nih.gov/12785718/
- International Organization for Standardization / International Electrotechnical Commission. ISO/IEC 17025:2017, General requirements for the competence of testing and calibration laboratories. https://www.iso.org/standard/66912.html
